SCOPe 2.05: Domain d5ec3a2: 5ec3 A:175-384

Lineage for d5ec3a2 (5ec3 A:175-384)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.3: Extradiol dioxygenases [54602] (5 proteins)
   duplication: consists of 2 similar domains with 2 repeats in each
   Similar to the Methylmalonyl-CoA epimerase dimer

6. Protein automated matches [276310] (2 species)
   not a true protein

7. Species Homo sapiens [TaxId:9606] [279455] (1 PDB entry)

8. Domain d5ec3a2: 5ec3 A:175-384 [279457]
   automated match to d3isqa2
   complexed with co

Details for d5ec3a2

PDB Entry: 5ec3, 2.1 Å

PDB Description: structural insight into the catalyitc mechanism of human 4- hydroxyphenylpyruvate dioxygenase

PDB Compounds: (A:) 4-hydroxyphenylpyruvate dioxygenase

SCOPe Domain Sequences for d5ec3a2:

Sequence; same for both SEQRES and ATOM records:

>d5ec3a2 d.32.1.3 (A:175-384) automated matches {Homo sapiens [TaxId: 9606]}
kcslemidhivgnqpdqemvsasewylknlqfhrfwsvddtqvhteysslrsivvanyee
sikmpinepapgkkksqiqeyvdynggagvqhialktediitairhlrergleflsvpst
yykqlreklktakikvkenidaleelkilvdydekgyllqiftkpvqdrptlfleviqrh
nhqgfgagnfnslfkafeeeqnlrgnltnm

Timeline for d5ec3a2:

• d5ec3a2 is new in SCOPe 2.05-stable
  
• d5ec3a2 appears in SCOPe 2.06
  
• d5ec3a2 appears in the current release, SCOPe 2.08