Lineage for d5e8fa_ (5e8f A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1770169Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1770659Family b.1.18.8: RhoGDI-like [81288] (3 proteins)
  6. 1770660Protein GMP-PDE delta [74846] (1 species)
  7. 1770661Species Human (Homo sapiens) [TaxId:9606] [74847] (11 PDB entries)
  8. 1770674Domain d5e8fa_: 5e8f A: [279454]
    automated match to d4jv8b_
    complexed with ger

Details for d5e8fa_

PDB Entry: 5e8f (more details), 2.1 Å

PDB Description: structure of fully modified geranylgeranylated pde6c peptide in complex with pde6d
PDB Compounds: (A:) Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta

SCOPe Domain Sequences for d5e8fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5e8fa_ b.1.18.8 (A:) GMP-PDE delta {Human (Homo sapiens) [TaxId: 9606]}
kderareilrgfklnwmnlrdaetgkilwqgtedlsvpgvehearvpkkilkckavsrel
nfssteqmekfrleqkvyfkgqcleewffefgfvipnstntwqslieaapesqmmpasvl
tgnviietkffdddllvstsrvrlfyv

SCOPe Domain Coordinates for d5e8fa_:

Click to download the PDB-style file with coordinates for d5e8fa_.
(The format of our PDB-style files is described here.)

Timeline for d5e8fa_: