SCOPe 2.03: Domain d1cnba_: 1cnb A:

Lineage for d1cnba_ (1cnb A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
   single sheet; 10 strands

4. Superfamily b.74.1: Carbonic anhydrase [51069] (2 families)

5. Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
   automatically mapped to Pfam PF00194

6. Protein Carbonic anhydrase [51071] (10 species)

7. Species Human (Homo sapiens), erythrocytes, isozyme II [TaxId:9606] [51073] (457 PDB entries)
   Uniprot P00918

8. Domain d1cnba_: 1cnb A: [27945]
   complexed with bme

Details for d1cnba_

PDB Entry: 1cnb, 2.35 Å

PDB Description: compensatory plastic effects in the redesign of protein-zinc binding sites

PDB Compounds: (A:) carbonic anhydrase II

SCOPe Domain Sequences for d1cnba_:

Sequence; same for both SEQRES and ATOM records:

>d1cnba_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II [TaxId: 9606]}
wgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnngh
afnvefddsqdkavlkggpldgtyrliqfcfhwgsldgqgsehtvdkkkyaaelhlvhwn
tkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprgll
pesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvdnw
rpaqplknrqikasf

Timeline for d1cnba_:

• d1cnba_ first appeared (with stable ids) in SCOP 1.55, called d1cnb__
  
• d1cnba_ appears in SCOPe 2.02
  
• d1cnba_ appears in SCOPe 2.04
  
• d1cnba_ appears in the current release, SCOPe 2.08