Lineage for d5e13a_ (5e13 A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1890050Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 1890051Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 1890052Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 1890445Protein automated matches [190061] (6 species)
    not a true protein
  7. 1890569Species Human (Homo sapiens) [TaxId:9606] [186903] (7 PDB entries)
  8. 1890574Domain d5e13a_: 5e13 A: [279448]
    automated match to d1k2aa_
    complexed with 5j9

Details for d5e13a_

PDB Entry: 5e13 (more details), 1.34 Å

PDB Description: crystal structure of eosinophil-derived neurotoxin in complex with the triazole double-headed ribonucleoside 11c
PDB Compounds: (A:) Non-secretory ribonuclease

SCOPe Domain Sequences for d5e13a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5e13a_ d.5.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mkppqftwaqwfetqhinmtsqqctnamqvinnyqrrcknqntfllttfanvvnvcgnpn
mtcpsnktrknchhsgsqvplihcnlttpspqnisncryaqtpanmfyivacdnrdqrrd
ppqypvvpvhldrii

SCOPe Domain Coordinates for d5e13a_:

Click to download the PDB-style file with coordinates for d5e13a_.
(The format of our PDB-style files is described here.)

Timeline for d5e13a_: