Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.5: RNase A-like [54075] (1 superfamily) contains long curved beta-sheet and 3 helices |
Superfamily d.5.1: RNase A-like [54076] (2 families) can be classified as disulfide-rich |
Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins) |
Protein automated matches [190061] (6 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186903] (7 PDB entries) |
Domain d5e13a_: 5e13 A: [279448] automated match to d1k2aa_ complexed with 5j9 |
PDB Entry: 5e13 (more details), 1.34 Å
SCOPe Domain Sequences for d5e13a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5e13a_ d.5.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} mkppqftwaqwfetqhinmtsqqctnamqvinnyqrrcknqntfllttfanvvnvcgnpn mtcpsnktrknchhsgsqvplihcnlttpspqnisncryaqtpanmfyivacdnrdqrrd ppqypvvpvhldrii
Timeline for d5e13a_: