Lineage for d5d7rb_ (5d7r B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1924588Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 1924589Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 1925132Family d.122.1.0: automated matches [227160] (1 protein)
    not a true family
  6. 1925133Protein automated matches [226867] (13 species)
    not a true protein
  7. 1925204Species Staphylococcus aureus [TaxId:1280] [232247] (14 PDB entries)
  8. 1925216Domain d5d7rb_: 5d7r B: [279441]
    automated match to d3u2ka_
    protein/DNA complex; complexed with 57y, cl, mg, mpd

Details for d5d7rb_

PDB Entry: 5d7r (more details), 1.55 Å

PDB Description: crystal structure of the atp binding domain of s. aureus gyrb complexed with a ligand
PDB Compounds: (B:) DNA gyrase subunit b

SCOPe Domain Sequences for d5d7rb_:

Sequence, based on SEQRES records: (download)

>d5d7rb_ d.122.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 1280]}
iqvlegleavrkrpgmyigstserglhhlvweivdnsidealagyanqievviekdnwik
vtdngrgipvdiqekmgrpaveviltssvvnalsqdlevyvhrnetiyhqaykkgvpqfd
lkevgttdktgtvirfkadgeiftettvynyetlqqrirelaflnkgiqitlrderdeen
vredsyhyeg

Sequence, based on observed residues (ATOM records): (download)

>d5d7rb_ d.122.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 1280]}
iqvlegleavrkrpgmyigstserglhhlvweivdnsidealagyanqievviekdnwik
vtdngrgipvdiqgrpaveviltssvvnalsqdlevyvhrnetiyhqaykkgvpqfdlke
vgttdktgtvirfkadgeiftettvynyetlqqrirelaflnkgiqitlrderdeenvre
dsyhyeg

SCOPe Domain Coordinates for d5d7rb_:

Click to download the PDB-style file with coordinates for d5d7rb_.
(The format of our PDB-style files is described here.)

Timeline for d5d7rb_: