SCOPe 2.01: Domain d12caa_: 12ca A:

Lineage for d12caa_ (12ca A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
   single sheet; 10 strands

4. Superfamily b.74.1: Carbonic anhydrase [51069] (2 families)

5. Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)

6. Protein Carbonic anhydrase [51071] (10 species)

7. Species Human (Homo sapiens), erythrocytes, isozyme II [TaxId:9606] [51073] (370 PDB entries)
   Uniprot P00918

8. Domain d12caa_: 12ca A: [27942]
   complexed with hg, zn; mutant

Details for d12caa_

PDB Entry: 12ca, 2.4 Å

PDB Description: altering the mouth of a hydrophobic pocket. structure and kinetics of human carbonic anhydrase ii mutants at residue val-121

PDB Compounds: (A:) carbonic anhydrase II

SCOPe Domain Sequences for d12caa_:

Sequence; same for both SEQRES and ATOM records:

>d12caa_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II [TaxId: 9606]}
wgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnngh
afnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhlahwn
tkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprgll
pesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvdnw
rpaqplknrqikasf

Timeline for d12caa_:

• d12caa_ first appeared (with stable ids) in SCOP 1.55, called d12ca__
  
• d12caa_ appears in SCOP 1.75
  
• d12caa_ appears in SCOPe 2.02
  
• d12caa_ appears in the current release, SCOPe 2.08