Lineage for d5bnpc_ (5bnp C:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2086376Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2086604Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2087272Family b.121.4.0: automated matches [191569] (1 protein)
    not a true family
  6. 2087273Protein automated matches [190988] (13 species)
    not a true protein
  7. 2087299Species Enterovirus d68 [TaxId:42789] [269068] (5 PDB entries)
  8. 2087303Domain d5bnpc_: 5bnp C: [279412]
    automated match to d3vbhc_
    complexed with 4u2

Details for d5bnpc_

PDB Entry: 5bnp (more details), 2.15 Å

PDB Description: crystal structure of human enterovirus d68 in complex with 3'sln
PDB Compounds: (C:) capsid protein vp3

SCOPe Domain Sequences for d5bnpc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bnpc_ b.121.4.0 (C:) automated matches {Enterovirus d68 [TaxId: 42789]}
gvptyllpgsgqflttddhssapvlpcfnptpemhipgqirnmlemiqvesmmeinntdg
angmerlrvdisvqadldqllfnipldiqldgplrntlvgnisryythwsgslemtfmfc
gsfmatgklilcytppggscpttretamlgthivwdfglqssitliipwisgshyrmfns
dakstnanvgyvtcfmqtnlivpsessdtcsligfiaakddfslrlmrdspdigqsnhlh
gaeaayq

SCOPe Domain Coordinates for d5bnpc_:

Click to download the PDB-style file with coordinates for d5bnpc_.
(The format of our PDB-style files is described here.)

Timeline for d5bnpc_: