Lineage for d5a8ga_ (5a8g A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1821671Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 1822946Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 1822947Protein automated matches [190115] (63 species)
    not a true protein
  7. 1823382Species Staphylococcus aureus [TaxId:93061] [193178] (6 PDB entries)
  8. 1823395Domain d5a8ga_: 5a8g A: [279408]
    automated match to d4ahob_

Details for d5a8ga_

PDB Entry: 5a8g (more details), 1.72 Å

PDB Description: crystal structure of the wild-type staphylococcus aureus n- acetylneurminic acid lyase in complex with fluoropyruvate
PDB Compounds: (A:) n-acetylneuraminate lyase

SCOPe Domain Sequences for d5a8ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5a8ga_ c.1.10.0 (A:) automated matches {Staphylococcus aureus [TaxId: 93061]}
kdlkglyaallvpfdengqvneqglkqiaqnaieteeldglyvngssgenfllnteqkkq
vfkvakeavgdkvkliaqvgsldlneaielgkyatelgydalsavtpfyypftfeeirdy
yfdiieatqnnmiiyaipdltgvnisieqfselfnhekivgvxytapnffllerirkafp
dklilsgfdemlvqatisgvdgaigstynvngrrarkifdlarqgqiqeayqlqhdsndi
ietvlsmgiyptlkeilrhrgidaglpkrpfkpfneahrqtldqliakydl

SCOPe Domain Coordinates for d5a8ga_:

Click to download the PDB-style file with coordinates for d5a8ga_.
(The format of our PDB-style files is described here.)

Timeline for d5a8ga_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5a8gb_