SCOPe 2.05: Domain d4zrga1: 4zrg A:11-182

Lineage for d4zrga1 (4zrg A:11-182)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.11: Arrestin/Vps26-like [81291] (2 proteins)

6. Protein automated matches [227018] (1 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [225765] (5 PDB entries)

8. Domain d4zrga1: 4zrg A:11-182 [279401]
   automated match to d1cf1a1
   complexed with co2; mutant

Details for d4zrga1

PDB Entry: 4zrg, 2.7 Å

PDB Description: visual arrestin mutant - r175e

PDB Compounds: (A:) S-arrestin

SCOPe Domain Sequences for d4zrga1:

Sequence, based on SEQRES records:

>d4zrga1 b.1.18.11 (A:11-182) automated matches {Cow (Bos taurus) [TaxId: 9913]}
vifkkisrdksvtiylgkrdyidhvervepvdgvvlvdpelvkgkrvyvsltcafrygqe
didvmglsfrrdlyfsqvqvfppvgasgattrlqeslikklgantypflltfpdylpcsv
mlqpapqdvgkscgvdfeikafathstdveedkipkkssvrlliekvqhapr

Sequence, based on observed residues (ATOM records):

>d4zrga1 b.1.18.11 (A:11-182) automated matches {Cow (Bos taurus) [TaxId: 9913]}
vifkkisrdksvtiylgkrdyidhvervepvdgvvlvdpelvkgkrvyvsltcafryggl
sfrrdlyfsqvqvfppvgasgattrlqeslikklgantypflltfpdylpcsvmlqpapq
dvgkscgvdfeikafathstdveedkipkkssvrlliekvqhapr

Timeline for d4zrga1:

• d4zrga1 is new in SCOPe 2.05-stable
  
• d4zrga1 appears in SCOPe 2.06
  
• d4zrga1 appears in the current release, SCOPe 2.08