Lineage for d4zi2a1 (4zi2 A:3-182)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2124192Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2124193Protein ADP-ribosylation factor [52614] (16 species)
  7. 2124263Species Mouse (Mus musculus), ARL2 [TaxId:10090] [75203] (5 PDB entries)
  8. 2124266Domain d4zi2a1: 4zi2 A:3-182 [279400]
    Other proteins in same PDB: d4zi2a2
    automated match to d1ksga_
    complexed with gnp, mg

Details for d4zi2a1

PDB Entry: 4zi2 (more details), 2.2 Å

PDB Description: bart-like domain of bartl1/ccdc104 in complex with arl3fl bound to gppnhp in p21 21 21
PDB Compounds: (A:) ADP-ribosylation factor-like protein 3

SCOPe Domain Sequences for d4zi2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zi2a1 c.37.1.8 (A:3-182) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]}
llsilrklksapdqevrilllgldnagkttllkqlasedishitptqgfniksvqsqgfk
lnvwdiggqrkirpywrsyfentdiliyvidsadrkrfeetgqeltelleeeklscvpvl
ifankqdlltaapaseiaeglnlhtirdrvwqiqscsaltgegvqdgmnwvcknvnakkk

SCOPe Domain Coordinates for d4zi2a1:

Click to download the PDB-style file with coordinates for d4zi2a1.
(The format of our PDB-style files is described here.)

Timeline for d4zi2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4zi2a2
View in 3D
Domains from other chains:
(mouse over for more information)
d4zi2b_