SCOPe 2.06: Domain d4zi2a1: 4zi2 A:3-182

Lineage for d4zi2a1 (4zi2 A:3-182)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein ADP-ribosylation factor [52614] (16 species)

7. Species Mouse (Mus musculus), ARL2 [TaxId:10090] [75203] (5 PDB entries)

8. Domain d4zi2a1: 4zi2 A:3-182 [279400]
   Other proteins in same PDB: d4zi2a2
   automated match to d1ksga_
   complexed with gnp, mg

Details for d4zi2a1

PDB Entry: 4zi2, 2.2 Å

PDB Description: bart-like domain of bartl1/ccdc104 in complex with arl3fl bound to gppnhp in p21 21 21

PDB Compounds: (A:) ADP-ribosylation factor-like protein 3

SCOPe Domain Sequences for d4zi2a1:

Sequence; same for both SEQRES and ATOM records:

>d4zi2a1 c.37.1.8 (A:3-182) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]}
llsilrklksapdqevrilllgldnagkttllkqlasedishitptqgfniksvqsqgfk
lnvwdiggqrkirpywrsyfentdiliyvidsadrkrfeetgqeltelleeeklscvpvl
ifankqdlltaapaseiaeglnlhtirdrvwqiqscsaltgegvqdgmnwvcknvnakkk

Timeline for d4zi2a1:

• d4zi2a1 first appeared in SCOPe 2.05, called d4zi2a_
  
• d4zi2a1 appears in SCOPe 2.07
  
• d4zi2a1 appears in the current release, SCOPe 2.08