Lineage for d4xm8a2 (4xm8 A:551-776)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1917420Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 1917421Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 1918408Family d.92.1.14: Anthrax toxin lethal factor, N- and C-terminal domains [69775] (2 proteins)
    automatically mapped to Pfam PF07737
  6. 1918442Protein automated matches [234341] (1 species)
    not a true protein
  7. 1918443Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [234342] (14 PDB entries)
  8. 1918455Domain d4xm8a2: 4xm8 A:551-776 [279374]
    Other proteins in same PDB: d4xm8a1
    automated match to d1j7na2
    complexed with 41t, zn

Details for d4xm8a2

PDB Entry: 4xm8 (more details), 2.7 Å

PDB Description: anthrax toxin lethal factor with ligand-induced binding pocket
PDB Compounds: (A:) Lethal Factor

SCOPe Domain Sequences for d4xm8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xm8a2 d.92.1.14 (A:551-776) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
pkskidtkiqeaqlninqewnkalglpkytklitfnvhnryasnivesaylilnewknni
qsdlikkvtnylvdgngrfvftditlpniaeqythqdeiyeqvhskglyvpesrsillhg
pskgvelrndsegfihefghavddyagylldknqsdlvtnskkfidifkeegsnltsygr
tneaeffaeafrlmhstdhaerlkvqknapktfqfindqikfiins

SCOPe Domain Coordinates for d4xm8a2:

Click to download the PDB-style file with coordinates for d4xm8a2.
(The format of our PDB-style files is described here.)

Timeline for d4xm8a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4xm8a1