Lineage for d4xdda3 (4xdd A:210-582)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1882411Fold c.96: Fe-only hydrogenase [53919] (1 superfamily)
    consist of two intertwined domains; contains partial duplication
  4. 1882412Superfamily c.96.1: Fe-only hydrogenase [53920] (1 family) (S)
    automatically mapped to Pfam PF02906
  5. 1882413Family c.96.1.1: Fe-only hydrogenase [53921] (3 proteins)
  6. 1882424Protein automated matches [279207] (1 species)
    not a true protein
  7. 1882425Species Clostridium pasteurianum [TaxId:1501] [279208] (5 PDB entries)
  8. 1882426Domain d4xdda3: 4xdd A:210-582 [279362]
    Other proteins in same PDB: d4xdda1, d4xdda2, d4xddb1, d4xddb2
    automated match to d3c8ya1
    complexed with cl, fes, gol, mg, sf4

Details for d4xdda3

PDB Entry: 4xdd (more details), 1.6 Å

PDB Description: apo [fefe]-hydrogenase cpi
PDB Compounds: (A:) Iron hydrogenase 1

SCOPe Domain Sequences for d4xdda3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xdda3 c.96.1.1 (A:210-582) automated matches {Clostridium pasteurianum [TaxId: 1501]}
hmdrvknalnapekhvivamapsvrasigelfnmgfgvdvtgkiytalrqlgfdkifdin
fgadmtimeeatelvqrienngpfpmftsccpgwvrqaenyypellnnlssakspqqifg
tasktyypsisgldpknvftvtvmpctskkfeadrpqmekdglrdidavittrelakmik
dakipfakledseadpamgeysgagaifgatggvmeaalrsakdfaenaeledieykqvr
glngikeaeveinnnkynvavingasnlfkfmksgminekqyhfievmachggcvngggq
phvnpkdlekvdikkvrasvlynqdehlskrkshentalvkmyqnyfgkpgegraheilh
fkykksawshpqf

SCOPe Domain Coordinates for d4xdda3:

Click to download the PDB-style file with coordinates for d4xdda3.
(The format of our PDB-style files is described here.)

Timeline for d4xdda3: