SCOPe 2.01: Domain d1cvha_: 1cvh A:

Lineage for d1cvha_ (1cvh A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
   single sheet; 10 strands

4. Superfamily b.74.1: Carbonic anhydrase [51069] (2 families)

5. Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)

6. Protein Carbonic anhydrase [51071] (10 species)

7. Species Human (Homo sapiens), erythrocytes, isozyme II [TaxId:9606] [51073] (370 PDB entries)
   Uniprot P00918

8. Domain d1cvha_: 1cvh A: [27936]
   complexed with zn

Details for d1cvha_

PDB Entry: 1cvh, 2.3 Å

PDB Description: structural consequences of redesigning a protein-zinc binding site

PDB Compounds: (A:) carbonic anhydrase II

SCOPe Domain Sequences for d1cvha_:

Sequence; same for both SEQRES and ATOM records:

>d1cvha_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II [TaxId: 9606]}
wgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnngh
afnvefddsqdkavlkggpldgtyrliqfhfcwgsldgqgsehtvdkkkyaaelhlvhwn
tkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprgll
pesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvdnw
rpaqplknrqikasf

Timeline for d1cvha_:

• d1cvha_ first appeared (with stable ids) in SCOP 1.55, called d1cvh__
  
• d1cvha_ appears in SCOP 1.75
  
• d1cvha_ appears in SCOPe 2.02
  
• d1cvha_ appears in the current release, SCOPe 2.08