SCOPe 2.05: Domain d4xddb1: 4xdd B:1-126

Lineage for d4xddb1 (4xdd B:1-126)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families)

5. Family d.15.4.0: automated matches [191632] (1 protein)
   not a true family

6. Protein automated matches [191164] (14 species)
   not a true protein

7. Species Clostridium pasteurianum [TaxId:1501] [279203] (5 PDB entries)

8. Domain d4xddb1: 4xdd B:1-126 [279357]
   Other proteins in same PDB: d4xdda2, d4xdda3, d4xddb2, d4xddb3
   automated match to d3c8ya2
   complexed with cl, fes, gol, mg, sf4

Details for d4xddb1

PDB Entry: 4xdd, 1.6 Å

PDB Description: apo [fefe]-hydrogenase cpi

PDB Compounds: (B:) Iron hydrogenase 1

SCOPe Domain Sequences for d4xddb1:

Sequence; same for both SEQRES and ATOM records:

>d4xddb1 d.15.4.0 (B:1-126) automated matches {Clostridium pasteurianum [TaxId: 1501]}
mktiiingvqfntdedttilkfardnnidisalcflnncnndinkceictvevegtglvt
acdtliedgmiintnsdavnekiksrisqlldihefkcgpcnrrenceflklvikykara
skpflp

Timeline for d4xddb1:

• d4xddb1 is new in SCOPe 2.05-stable
  
• d4xddb1 appears in SCOPe 2.06
  
• d4xddb1 appears in the current release, SCOPe 2.08