Lineage for d4wl3d_ (4wl3 D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2995888Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2995889Protein automated matches [190509] (19 species)
    not a true protein
  7. 2996329Species Enterococcus faecalis [TaxId:565637] [279343] (3 PDB entries)
  8. 2996333Domain d4wl3d_: 4wl3 D: [279347]
    automated match to d2bjfa_

Details for d4wl3d_

PDB Entry: 4wl3 (more details), 2.01 Å

PDB Description: crystal structure determination of bile salt hydrolase from enterococcus feacalis
PDB Compounds: (D:) Bile salt hydrolase

SCOPe Domain Sequences for d4wl3d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wl3d_ d.153.1.0 (D:) automated matches {Enterococcus faecalis [TaxId: 565637]}
ctaityvskdhyfgrnfdyeisynevvtitprnykfsfrevgnldhhfaiigiaagiady
plyydainekglgmaglnfsgyadykkieegkenvspfefipwvlgqcstvdeakkllkn
lnlvninfsdelplsplhwlladkeqsivvestkeglrvfdnpvgvltnnptfdyqlfnl
nnyrvlstrtpknnfsdqieldiysrgmggiglpgdlssvsrfvkatftklnsvsrssey
esisqffhilssveqqkglcdvgdekyeytiyssccnlekgiyyyrtydnsqitavdmnk
enlekdslivypmvetqqinyan

SCOPe Domain Coordinates for d4wl3d_:

Click to download the PDB-style file with coordinates for d4wl3d_.
(The format of our PDB-style files is described here.)

Timeline for d4wl3d_: