Lineage for d5fl6a_ (5fl6 A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1804997Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 1804998Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 1805718Family b.74.1.0: automated matches [191576] (1 protein)
    not a true family
  6. 1805719Protein automated matches [191011] (12 species)
    not a true protein
  7. 1805768Species Human (Homo sapiens) [TaxId:9606] [188766] (10 PDB entries)
  8. 1805786Domain d5fl6a_: 5fl6 A: [279325]
    automated match to d3iaia_
    complexed with acy, gol, y0r, zn

Details for d5fl6a_

PDB Entry: 5fl6 (more details), 1.95 Å

PDB Description: three dimensional structure of human carbonic anhydrase ix in complex with 5-(1-(4-methylphenyl)-1h-1,2,3-triazol-4-yl)thiophene-2- sulfonamide
PDB Compounds: (A:) carbonic anhydrase ix

SCOPe Domain Sequences for d5fl6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fl6a_ b.74.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
wryggdppwprvspacagrfqspvdirpqlaafspalrplellgfqlpplpelrlrnngh
svqltlppglemalgpgreyralqlhlhwgaagrpgsehtveghrfpaeihvvhlstafa
rvdealgrpgglavlaafleegpeensayeqllsrleeiaeegsetqvpgldisallpsd
fsryfqyegslttppcaqgviwtvfnqtvmlsakqlhtlsdtlwgpgdsrlqlnfratqp
lngrvieasfp

SCOPe Domain Coordinates for d5fl6a_:

Click to download the PDB-style file with coordinates for d5fl6a_.
(The format of our PDB-style files is described here.)

Timeline for d5fl6a_: