Lineage for d5egka_ (5egk A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943538Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2943539Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. 2944312Family d.38.1.0: automated matches [191325] (1 protein)
    not a true family
  6. 2944313Protein automated matches [190143] (42 species)
    not a true protein
  7. 2944593Species Staphylococcus aureus [TaxId:158878] [260692] (8 PDB entries)
  8. 2944600Domain d5egka_: 5egk A: [279301]
    automated match to d4ncpc_
    mutant

Details for d5egka_

PDB Entry: 5egk (more details), 2.4 Å

PDB Description: the structural and biochemical characterization of acyl-coa hydrolase mutant asp43ala from staphylococcus aureus
PDB Compounds: (A:) Acyl CoA Hydrolase

SCOPe Domain Sequences for d5egka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5egka_ d.38.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 158878]}
rpmksmseskcyknrqvfpqdtnhhhtmfggtlmaniaeiaaitamkhagaqvvtastds
vdflkpiktgdilqyvamvsyagtssmevvvqiriddvfnnkhdlaalsyltfvalddeg
kpkhvpgvypeddvekwfydtapqrverrkarrieskqtieylaqa

SCOPe Domain Coordinates for d5egka_:

Click to download the PDB-style file with coordinates for d5egka_.
(The format of our PDB-style files is described here.)

Timeline for d5egka_: