SCOPe 2.04: Domain d1ccua_: 1ccu A:

Lineage for d1ccua_ (1ccu A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
   single sheet; 10 strands

4. Superfamily b.74.1: Carbonic anhydrase [51069] (2 families)

5. Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
   automatically mapped to Pfam PF00194

6. Protein Carbonic anhydrase [51071] (10 species)

7. Species Human (Homo sapiens), erythrocytes, isozyme II [TaxId:9606] [51073] (477 PDB entries)
   Uniprot P00918

8. Domain d1ccua_: 1ccu A: [27929]
   complexed with so4, zn

Details for d1ccua_

PDB Entry: 1ccu, 2.25 Å

PDB Description: structure-assisted redesign of a protein-zinc binding site with femtomolar affinity

PDB Compounds: (A:) carbonic anhydrase II

SCOPe Domain Sequences for d1ccua_:

Sequence; same for both SEQRES and ATOM records:

>d1ccua_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II [TaxId: 9606]}
wgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnngh
afnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhlvhwn
tkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprgll
pesldywtypgslhtppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvdnw
rpaqplknrqikasf

Timeline for d1ccua_:

• d1ccua_ first appeared (with stable ids) in SCOP 1.55, called d1ccu__
  
• d1ccua_ appears in SCOPe 2.03
  
• d1ccua_ appears in SCOPe 2.05
  
• d1ccua_ appears in the current release, SCOPe 2.08