Lineage for d5csna1 (5csn A:0-90)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1996349Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1996350Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1996383Family a.39.1.2: S100 proteins [47478] (2 proteins)
    dimer: subunits are made of two EF-hands
  6. 1996384Protein Calcyclin (S100) [47479] (17 species)
  7. 1996549Species Human (Homo sapiens), s100b [TaxId:9606] [47483] (11 PDB entries)
  8. 1996561Domain d5csna1: 5csn A:0-90 [279242]
    Other proteins in same PDB: d5csna2, d5csnb2
    automated match to d3d10a_
    complexed with ca

Details for d5csna1

PDB Entry: 5csn (more details), 2.95 Å

PDB Description: s100b-rsk1 crystal structure c
PDB Compounds: (A:) Protein S100-B

SCOPe Domain Sequences for d5csna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5csna1 a.39.1.2 (A:0-90) Calcyclin (S100) {Human (Homo sapiens), s100b [TaxId: 9606]}
mselekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
ldndgdgecdfqefmafvamvttacheffeh

SCOPe Domain Coordinates for d5csna1:

Click to download the PDB-style file with coordinates for d5csna1.
(The format of our PDB-style files is described here.)

Timeline for d5csna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5csna2