SCOPe 2.06: Domain d5csnb1: 5csn B:0-88

Lineage for d5csnb1 (5csn B:0-88)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.2: S100 proteins [47478] (2 proteins)
   dimer: subunits are made of two EF-hands

6. Protein Calcyclin (S100) [47479] (17 species)

7. Species Human (Homo sapiens), s100b [TaxId:9606] [47483] (11 PDB entries)

8. Domain d5csnb1: 5csn B:0-88 [279238]
   Other proteins in same PDB: d5csna2, d5csnb2
   automated match to d3d10a_
   complexed with ca

Details for d5csnb1

PDB Entry: 5csn, 2.95 Å

PDB Description: s100b-rsk1 crystal structure c

PDB Compounds: (B:) Protein S100-B

SCOPe Domain Sequences for d5csnb1:

Sequence; same for both SEQRES and ATOM records:

>d5csnb1 a.39.1.2 (B:0-88) Calcyclin (S100) {Human (Homo sapiens), s100b [TaxId: 9606]}
mselekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
ldndgdgecdfqefmafvamvttacheff

Timeline for d5csnb1:

• d5csnb1 first appeared in SCOPe 2.05, called d5csnb_
  
• d5csnb1 appears in SCOPe 2.07
  
• d5csnb1 appears in the current release, SCOPe 2.08