SCOPe 2.05: Domain d5c6ya_: 5c6y A:

Lineage for d5c6ya_ (5c6y A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (9 species)

7. Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (245 PDB entries)
   Uniprot P02185

8. Domain d5c6ya_: 5c6y A: [279235]
   automated match to d4pnja_
   complexed with hem; mutant

Details for d5c6ya_

PDB Entry: 5c6y, 1.79 Å

PDB Description: a sperm whale myoglobin double mutant l29h/f43y mb with a tyr-heme cross-link

PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d5c6ya_:

Sequence; same for both SEQRES and ATOM records:

>d5c6ya_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
vlsegewqlvlhvwakveadvaghgqdihirlfkshpetlekydrfkhlkteaemkased
lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
gdfgadaqgamnkalelfrkdiaakykelgyqg

Timeline for d5c6ya_:

• d5c6ya_ is new in SCOPe 2.05-stable
  
• d5c6ya_ appears in SCOPe 2.06
  
• d5c6ya_ appears in the current release, SCOPe 2.08