SCOPe 2.06: Domain d5bxfc2: 5bxf C:177-267

Lineage for d5bxfc2 (5bxf C:177-267)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (16 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries)

8. Domain d5bxfc2: 5bxf C:177-267 [279226]
   Other proteins in same PDB: d5bxfa1, d5bxfb_, d5bxfc1, d5bxfd_
   automated match to d3frua1

Details for d5bxfc2

PDB Entry: 5bxf, 2.85 Å

PDB Description: apo fcrn structure at ph 4.5

PDB Compounds: (C:) igg receptor fcrn large subunit p51

SCOPe Domain Sequences for d5bxfc2:

Sequence; same for both SEQRES and ATOM records:

>d5bxfc2 b.1.1.2 (C:177-267) automated matches {Human (Homo sapiens) [TaxId: 9606]}
keppsmrlkarpsspgfsvltcsafsfyppelqlrflrnglaagtgqgdfgpnsdgsfha
sssltvksgdehhyccivqhaglaqplrvel

Timeline for d5bxfc2:

• d5bxfc2 first appeared in SCOPe 2.05
  
• d5bxfc2 appears in SCOPe 2.07
  
• d5bxfc2 appears in the current release, SCOPe 2.08