Lineage for d5bxfc2 (5bxf C:177-267)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1762660Protein automated matches [190374] (14 species)
    not a true protein
  7. 1762674Species Homo sapiens [TaxId:9606] [268989] (70 PDB entries)
  8. 1762779Domain d5bxfc2: 5bxf C:177-267 [279226]
    Other proteins in same PDB: d5bxfa1, d5bxfb_, d5bxfc1, d5bxfd_
    automated match to d3frua1

Details for d5bxfc2

PDB Entry: 5bxf (more details), 2.85 Å

PDB Description: apo fcrn structure at ph 4.5
PDB Compounds: (C:) igg receptor fcrn large subunit p51

SCOPe Domain Sequences for d5bxfc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bxfc2 b.1.1.2 (C:177-267) automated matches {Homo sapiens [TaxId: 9606]}
keppsmrlkarpsspgfsvltcsafsfyppelqlrflrnglaagtgqgdfgpnsdgsfha
sssltvksgdehhyccivqhaglaqplrvel

SCOPe Domain Coordinates for d5bxfc2:

Click to download the PDB-style file with coordinates for d5bxfc2.
(The format of our PDB-style files is described here.)

Timeline for d5bxfc2: