Lineage for d5bxfc1 (5bxf C:5-176)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2182595Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2182596Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2183623Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2183624Protein automated matches [226842] (4 species)
    not a true protein
  7. 2183637Species Human (Homo sapiens) [TaxId:9606] [226044] (65 PDB entries)
  8. 2183763Domain d5bxfc1: 5bxf C:5-176 [279225]
    Other proteins in same PDB: d5bxfa2, d5bxfb_, d5bxfc2, d5bxfd_
    automated match to d3frua2

Details for d5bxfc1

PDB Entry: 5bxf (more details), 2.85 Å

PDB Description: apo fcrn structure at ph 4.5
PDB Compounds: (C:) igg receptor fcrn large subunit p51

SCOPe Domain Sequences for d5bxfc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bxfc1 d.19.1.0 (C:5-176) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lsllyhltavsspapgtpafwvsgwlgpqqylsynslrgeaepcgawvwenqvswyweke
ttdlrikeklfleafkalggkgpytlqgllgcelgpdntsvptakfalngeefmnfdlkq
gtwggdwpealaisqrwqqqdkaankeltfllfscphrlrehlergrgnlew

SCOPe Domain Coordinates for d5bxfc1:

Click to download the PDB-style file with coordinates for d5bxfc1.
(The format of our PDB-style files is described here.)

Timeline for d5bxfc1: