Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
Protein automated matches [226842] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [226044] (65 PDB entries) |
Domain d5bxfc1: 5bxf C:5-176 [279225] Other proteins in same PDB: d5bxfa2, d5bxfb_, d5bxfc2, d5bxfd_ automated match to d3frua2 |
PDB Entry: 5bxf (more details), 2.85 Å
SCOPe Domain Sequences for d5bxfc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5bxfc1 d.19.1.0 (C:5-176) automated matches {Human (Homo sapiens) [TaxId: 9606]} lsllyhltavsspapgtpafwvsgwlgpqqylsynslrgeaepcgawvwenqvswyweke ttdlrikeklfleafkalggkgpytlqgllgcelgpdntsvptakfalngeefmnfdlkq gtwggdwpealaisqrwqqqdkaankeltfllfscphrlrehlergrgnlew
Timeline for d5bxfc1:
View in 3D Domains from other chains: (mouse over for more information) d5bxfa1, d5bxfa2, d5bxfb_, d5bxfd_ |