Lineage for d5bysa2 (5bys A:127-209)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2192664Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 2193004Family d.58.1.0: automated matches [229598] (1 protein)
    not a true family
  6. 2193005Protein automated matches [229599] (3 species)
    not a true protein
  7. 2193006Species Clostridium pasteurianum [TaxId:1501] [279205] (7 PDB entries)
  8. 2193015Domain d5bysa2: 5bys A:127-209 [279223]
    Other proteins in same PDB: d5bysa1, d5bysa3, d5bysa4, d5bysb1, d5bysb3
    automated match to d3c8ya3
    complexed with 4wx, fes, mg, sf4

Details for d5bysa2

PDB Entry: 5bys (more details), 1.93 Å

PDB Description: semisynthetic [fefe]-hydrogenase cpi with sulfur-dithiolato-bridged [2fe] cofactor
PDB Compounds: (A:) Iron hydrogenase 1

SCOPe Domain Sequences for d5bysa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bysa2 d.58.1.0 (A:127-209) automated matches {Clostridium pasteurianum [TaxId: 1501]}
kdkteyvdersksltvdrtkcllcgrcvnacgkntetyamkflnkngktiigaedekcfd
dtncllcgqciiacpvaalseks

SCOPe Domain Coordinates for d5bysa2:

Click to download the PDB-style file with coordinates for d5bysa2.
(The format of our PDB-style files is described here.)

Timeline for d5bysa2: