Lineage for d5byqb3 (5byq B:210-577)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1882411Fold c.96: Fe-only hydrogenase [53919] (1 superfamily)
    consist of two intertwined domains; contains partial duplication
  4. 1882412Superfamily c.96.1: Fe-only hydrogenase [53920] (1 family) (S)
    automatically mapped to Pfam PF02906
  5. 1882413Family c.96.1.1: Fe-only hydrogenase [53921] (3 proteins)
  6. 1882424Protein automated matches [279207] (1 species)
    not a true protein
  7. 1882425Species Clostridium pasteurianum [TaxId:1501] [279208] (5 PDB entries)
  8. 1882431Domain d5byqb3: 5byq B:210-577 [279215]
    Other proteins in same PDB: d5byqa1, d5byqa2, d5byqb1, d5byqb2
    automated match to d3c8ya1
    complexed with 4wv, fes, gol, mg, sf4

Details for d5byqb3

PDB Entry: 5byq (more details), 1.73 Å

PDB Description: semisynthetic [fefe]-hydrogenase cpi with oxodithiolato-bridged [2fe] cofactor
PDB Compounds: (B:) Iron hydrogenase 1

SCOPe Domain Sequences for d5byqb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5byqb3 c.96.1.1 (B:210-577) automated matches {Clostridium pasteurianum [TaxId: 1501]}
hmdrvknalnapekhvivamapsvrasigelfnmgfgvdvtgkiytalrqlgfdkifdin
fgadmtimeeatelvqrienngpfpmftsccpgwvrqaenyypellnnlssakspqqifg
tasktyypsisgldpknvftvtvmpctskkfeadrpqmekdglrdidavittrelakmik
dakipfakledseadpamgeysgagaifgatggvmeaalrsakdfaenaeledieykqvr
glngikeaeveinnnkynvavingasnlfkfmksgminekqyhfievmachggcvngggq
phvnpkdlekvdikkvrasvlynqdehlskrkshentalvkmyqnyfgkpgegraheilh
fkykksaw

SCOPe Domain Coordinates for d5byqb3:

Click to download the PDB-style file with coordinates for d5byqb3.
(The format of our PDB-style files is described here.)

Timeline for d5byqb3: