SCOPe 2.06: Domain d5bsff2: 5bsf F:170-274

Lineage for d5bsff2 (5bsf F:170-274)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.0: automated matches [227147] (1 protein)
   not a true family

6. Protein automated matches [226851] (35 species)
   not a true protein

7. Species Medicago truncatula [TaxId:3880] [279125] (4 PDB entries)

8. Domain d5bsff2: 5bsf F:170-274 [279196]
   Other proteins in same PDB: d5bsfa1, d5bsfb1, d5bsfc1, d5bsfd1, d5bsfe1, d5bsff1, d5bsfg1, d5bsfh1, d5bsfi1, d5bsfj1
   automated match to d2izza2
   complexed with cl, mpo, nad

Details for d5bsff2

PDB Entry: 5bsf, 1.85 Å

PDB Description: crystal structure of medicago truncatula (delta)1-pyrroline-5- carboxylate reductase (mtp5cr) in complex with nad+

PDB Compounds: (F:) pyrroline-5-carboxylate reductase

SCOPe Domain Sequences for d5bsff2:

Sequence; same for both SEQRES and ATOM records:

>d5bsff2 a.100.1.0 (F:170-274) automated matches {Medicago truncatula [TaxId: 3880]}
kyfdaitglsgsgpayiylaiealadggvaaglprdlalslasqtvlgaasmatqsgkhp
gqlkddvtspggttiagvhelekagfrgilmnavvaaakrsqels

Timeline for d5bsff2:

• d5bsff2 first appeared in SCOPe 2.05
  
• d5bsff2 appears in SCOPe 2.07
  
• d5bsff2 appears in the current release, SCOPe 2.08