Lineage for d5bseb2 (5bse B:170-274)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1742411Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 1742412Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 1742617Family a.100.1.0: automated matches [227147] (1 protein)
    not a true family
  6. 1742618Protein automated matches [226851] (30 species)
    not a true protein
  7. 1742756Species Medicago truncatula [TaxId:3880] [279125] (4 PDB entries)
  8. 1742758Domain d5bseb2: 5bse B:170-274 [279148]
    Other proteins in same PDB: d5bsea1, d5bseb1, d5bsec1, d5bsed1, d5bsee1, d5bsef1, d5bseg1, d5bseh1, d5bsei1, d5bsej1
    automated match to d2izza2
    complexed with cl, mpo

Details for d5bseb2

PDB Entry: 5bse (more details), 1.7 Å

PDB Description: crystal structure of medicago truncatula (delta)1-pyrroline-5- carboxylate reductase (mtp5cr)
PDB Compounds: (B:) pyrroline-5-carboxylate reductase

SCOPe Domain Sequences for d5bseb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bseb2 a.100.1.0 (B:170-274) automated matches {Medicago truncatula [TaxId: 3880]}
kyfdaitglsgsgpayiylaiealadggvaaglprdlalslasqtvlgaasmatqsgkhp
gqlkddvtspggttiagvhelekagfrgilmnavvaaakrsqels

SCOPe Domain Coordinates for d5bseb2:

Click to download the PDB-style file with coordinates for d5bseb2.
(The format of our PDB-style files is described here.)

Timeline for d5bseb2: