SCOPe 2.05: Domain d5bsge1: 5bsg E:3-169

Lineage for d5bsge1 (5bsg E:3-169)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (203 species)
   not a true protein

7. Species Medicago truncatula [TaxId:3880] [259991] (7 PDB entries)

8. Domain d5bsge1: 5bsg E:3-169 [279124]
   Other proteins in same PDB: d5bsga2, d5bsgb2, d5bsgc2, d5bsgd2, d5bsge2, d5bsgf2, d5bsgg2, d5bsgh2, d5bsgi2, d5bsgj2
   automated match to d2izzd1
   complexed with cl, mpo, nap

Details for d5bsge1

PDB Entry: 5bsg, 1.95 Å

PDB Description: crystal structure of medicago truncatula (delta)1-pyrroline-5- carboxylate reductase (mtp5cr) in complex with nadp+

PDB Compounds: (E:) pyrroline-5-carboxylate reductase

SCOPe Domain Sequences for d5bsge1:

Sequence; same for both SEQRES and ATOM records:

>d5bsge1 c.2.1.0 (E:3-169) automated matches {Medicago truncatula [TaxId: 3880]}
iipipadsytlgfigagkmaesiakgavrsgvlspsriktaihsnparrtafesigitvl
ssnddvvrdsnvvvfsvkpqllkdvvlklkplltkdkllvsvaagikmkdlqewagherf
irvmpntaatvgeaasvmslggaateedanlisqlfgsigkiwkadd

Timeline for d5bsge1:

• d5bsge1 is new in SCOPe 2.05-stable
  
• d5bsge1 appears in SCOPe 2.06
  
• d5bsge1 appears in the current release, SCOPe 2.08