Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
Superfamily d.2.1: Lysozyme-like [53955] (12 families) |
Family d.2.1.2: C-type lysozyme [53960] (3 proteins) automatically mapped to Pfam PF00062 |
Protein automated matches [190299] (7 species) not a true protein |
Species Chicken (Gallus gallus) [TaxId:9031] [196365] (15 PDB entries) |
Domain d5a3za_: 5a3z A: [279114] automated match to d1ghla_ complexed with gol, no3 |
PDB Entry: 5a3z (more details), 1.59 Å
SCOPe Domain Sequences for d5a3za_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5a3za_ d.2.1.2 (A:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} kvfgrcelaaamkrhgldnyrgyslgnwvcaakfesnfntqatnrntdgstdygilqins rwwcndgrtpgsrnlcnipcsallssditasvncakkivsdgngmnawvawrnrckgtdv qawirgcrl
Timeline for d5a3za_: