Lineage for d5awfb_ (5awf B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2079406Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2079659Superfamily b.80.6: Stabilizer of iron transporter SufD [101960] (1 family) (S)
    superhelix turns are made of two very long strands each
  5. 2079660Family b.80.6.1: Stabilizer of iron transporter SufD [101961] (1 protein)
    this is a repeat family; one repeat unit is 1vh4 A:307-339 found in domain
  6. 2079661Protein Stabilizer of iron transporter SufD [101962] (1 species)
  7. 2079662Species Escherichia coli [TaxId:562] [101963] (3 PDB entries)
  8. 2079667Domain d5awfb_: 5awf B: [279108]
    Other proteins in same PDB: d5awfc_, d5awfd_, d5awfg_, d5awfh_
    automated match to d2zu0a_

Details for d5awfb_

PDB Entry: 5awf (more details), 2.96 Å

PDB Description: crystal structure of sufb-sufc-sufd complex from escherichia coli
PDB Compounds: (B:) FeS cluster assembly protein SufD

SCOPe Domain Sequences for d5awfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5awfb_ b.80.6.1 (B:) Stabilizer of iron transporter SufD {Escherichia coli [TaxId: 562]}
snalqqwhhlfeaegtkrspqaqqhlqqllrtglptrkhenwkytpleglinsqfvsiag
eispqqrdalaltldsvrlvfvdgryvpalsdategsgyevsinddrqglpdaiqaevfl
hlteslaqsvthiavkrgqrpakplllmhitqgvageevntahyrhhldlaegaeatvie
hfvslndarhftgarftinvaanahlqhiklafenplshhfahndlllaedatafshsfl
lggavlrhntstqlngenstlrinslampvknevcdtrtwlehnkgfcnsrqlhktivsd
kgravfnglinvaqhaiktdgqmtnnnllmgklaevdtkpqleiyaddvkcshgatvgri
ddeqifylrsrginqqdaqqmiiyafaaeltealrdeglkqqvlarigqrlpgg

SCOPe Domain Coordinates for d5awfb_:

Click to download the PDB-style file with coordinates for d5awfb_.
(The format of our PDB-style files is described here.)

Timeline for d5awfb_: