Class b: All beta proteins [48724] (177 folds) |
Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
Superfamily b.80.6: Stabilizer of iron transporter SufD [101960] (1 family) superhelix turns are made of two very long strands each |
Family b.80.6.1: Stabilizer of iron transporter SufD [101961] (1 protein) this is a repeat family; one repeat unit is 1vh4 A:307-339 found in domain |
Protein Stabilizer of iron transporter SufD [101962] (1 species) |
Species Escherichia coli [TaxId:562] [101963] (3 PDB entries) |
Domain d5awff_: 5awf F: [279107] Other proteins in same PDB: d5awfc_, d5awfd_, d5awfg_, d5awfh_ automated match to d2zu0a_ |
PDB Entry: 5awf (more details), 2.96 Å
SCOPe Domain Sequences for d5awff_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5awff_ b.80.6.1 (F:) Stabilizer of iron transporter SufD {Escherichia coli [TaxId: 562]} snalqqwhhlfeaegtkrspqaqqhlqqllrtglptrkhenwkytpleglinsqfvsiag eispqqrdalaltldsvrlvfvdgryvpalsdategsgyevsinddrqglpdaiqaevfl hlteslaqsvthiavkrgqrpakplllmhitqgvageevntahyrhhldlaegaeatvie hfvslndarhftgarftinvaanahlqhiklafenplshhfahndlllaedatafshsfl lggavlrhntstqlngenstlrinslampvknevcdtrtwlehnkgfcnsrqlhktivsd kgravfnglinvaqhaiktdgqmtnnnllmgklaevdtkpqleiyaddvkcshgatvgri ddeqifylrsrginqqdaqqmiiyafaaeltealrdeglkqqvlarigqrlpgg
Timeline for d5awff_: