Lineage for d1dcba_ (1dcb A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1328735Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 1328736Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 1328737Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
    automatically mapped to Pfam PF00194
  6. 1328738Protein Carbonic anhydrase [51071] (10 species)
  7. 1328774Species Human (Homo sapiens), erythrocytes, isozyme II [TaxId:9606] [51073] (457 PDB entries)
    Uniprot P00918
  8. 1329168Domain d1dcba_: 1dcb A: [27909]
    complexed with zn

Details for d1dcba_

PDB Entry: 1dcb (more details), 2.1 Å

PDB Description: structure of an engineered metal binding site in human carbonic anhydrase ii reveals the architecture of a regulatory cysteine switch
PDB Compounds: (A:) carbonic anhydrase II

SCOPe Domain Sequences for d1dcba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dcba_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II [TaxId: 9606]}
wgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnngh
afnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhlvhwn
tkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprgll
pesldywtypgslctppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvdnw
rpaqplknrqikasf

SCOPe Domain Coordinates for d1dcba_:

Click to download the PDB-style file with coordinates for d1dcba_.
(The format of our PDB-style files is described here.)

Timeline for d1dcba_: