SCOPe 2.08: Domain d4zf7b_: 4zf7 B:

Lineage for d4zf7b_ (4zf7 B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)

6. Protein automated matches [190501] (4 species)
   not a true protein

7. Species Mustela putorius [TaxId:9669] [279075] (1 PDB entry)

8. Domain d4zf7b_: 4zf7 B: [279077]
   automated match to d1irla_
   complexed with 1pe, peg, pg4, so4

Details for d4zf7b_

PDB Entry: 4zf7, 1.89 Å

PDB Description: crystal structure of ferret interleukin-2

PDB Compounds: (B:) Interleukin 2

SCOPe Domain Sequences for d4zf7b_:

Sequence; same for both SEQRES and ATOM records:

>d4zf7b_ a.26.1.2 (B:) automated matches {Mustela putorius [TaxId: 9669]}
sstkeaqqqleqllldlqlllngvknyesprmltfkfympkkatelthlqclaeelklle
evlylaqsknfhltdikelmsninvtllklkgsetsfkceyddetvtiteflnkwitfcq
sifstlt

Timeline for d4zf7b_:

• d4zf7b_ first appeared in SCOPe 2.05
  
• d4zf7b_ appears in SCOPe 2.07