Lineage for d4z9fc_ (4z9f C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2846677Species Corynebacterium sp. [TaxId:1720] [279066] (4 PDB entries)
  8. 2846692Domain d4z9fc_: 4z9f C: [279072]
    automated match to d2ph3a_
    complexed with cl

Details for d4z9fc_

PDB Entry: 4z9f (more details), 1.75 Å

PDB Description: halohydrin hydrogen-halide-lyase, hhea
PDB Compounds: (C:) Halohydrin epoxidase A

SCOPe Domain Sequences for d4z9fc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4z9fc_ c.2.1.0 (C:) automated matches {Corynebacterium sp. [TaxId: 1720]}
mkialvtharhfagpaavealtrdgytvvchdasfadaaerqrfesenpgtvalaeqkpe
rlvdatlqhgeaidtivsndyiprpmnrlpiegtseadirqvfealsifpilllqsaiap
lraaggasvifitssvgkkplaynplygparaatvalvesaaktlsrdgillyaigpnff
nnptyfptsdwennpelrerverdvplgrlgrpdemgalitflasrraapivgqffaftg
gylp

SCOPe Domain Coordinates for d4z9fc_:

Click to download the PDB-style file with coordinates for d4z9fc_.
(The format of our PDB-style files is described here.)

Timeline for d4z9fc_: