SCOPe 2.05: Domain d4ylbc_: 4ylb C:

Lineage for d4ylbc_ (4ylb C:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.15: HSP20-like chaperones [49763] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.15.1: HSP20-like chaperones [49764] (5 families)

5. Family b.15.1.0: automated matches [191643] (1 protein)
   not a true family

6. Protein automated matches [191181] (5 species)
   not a true protein

7. Species Sulfolobus solfataricus [TaxId:555311] [279049] (3 PDB entries)

8. Domain d4ylbc_: 4ylb C: [279064]
   automated match to d3aaca_
   complexed with cl; mutant

Details for d4ylbc_

PDB Entry: 4ylb, 2.5 Å

PDB Description: crystal structure of a102d mutant of hsp14.1 from sulfolobus solfatataricus p2

PDB Compounds: (C:) Heat shock protein Hsp20

SCOPe Domain Sequences for d4ylbc_:

Sequence; same for both SEQRES and ATOM records:

>d4ylbc_ b.15.1.0 (C:) automated matches {Sulfolobus solfataricus [TaxId: 555311]}
gpgtmmnvimreigkkldelsrefyesvippidmyeeggelvvvadlagfnkdkisvrls
aqneliinaereiqyigtkyatqrplkihkvirlpvkvkrdsqvtdkyengvltiripve
gsvsiri

Timeline for d4ylbc_:

• d4ylbc_ is new in SCOPe 2.05-stable
  
• d4ylbc_ is called d4ylbc1 in SCOPe 2.06
  
• d4ylbc_ appears in the current release, SCOPe 2.08, called d4ylbc1