Class b: All beta proteins [48724] (176 folds) |
Fold b.15: HSP20-like chaperones [49763] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key |
Superfamily b.15.1: HSP20-like chaperones [49764] (5 families) |
Family b.15.1.0: automated matches [191643] (1 protein) not a true family |
Protein automated matches [191181] (5 species) not a true protein |
Species Sulfolobus solfataricus [TaxId:555311] [279049] (3 PDB entries) |
Domain d4ylbb_: 4ylb B: [279063] automated match to d3aaca_ complexed with cl; mutant |
PDB Entry: 4ylb (more details), 2.5 Å
SCOPe Domain Sequences for d4ylbb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ylbb_ b.15.1.0 (B:) automated matches {Sulfolobus solfataricus [TaxId: 555311]} gtmmnvimreigkkldelsrefyesvippidmyeeggelvvvadlagfnkdkisvrlsaq neliinaereiqyigtkyatqrplkihkvirlpvkvkrdsqvtdkyengvltiripv
Timeline for d4ylbb_: