SCOPe 2.06: Domain d2caba_: 2cab A:

Lineage for d2caba_ (2cab A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
   single sheet; 10 strands

4. Superfamily b.74.1: Carbonic anhydrase [51069] (2 families)

5. Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
   automatically mapped to Pfam PF00194

6. Protein Carbonic anhydrase [51071] (10 species)

7. Species Human (Homo sapiens), erythrocytes, isozyme II [TaxId:9606] [51073] (682 PDB entries)
   Uniprot P00918

8. Domain d2caba_: 2cab A: [27906]
   complexed with zn

Details for d2caba_

PDB Entry: 2cab, 2 Å

PDB Description: structure, refinement and function of carbonic anhydrase isozymes. refinement of human carbonic anhydrase i

PDB Compounds: (A:) carbonic anhydrase form b

SCOPe Domain Sequences for d2caba_:

Sequence; same for both SEQRES and ATOM records:

>d2caba_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II [TaxId: 9606]}
wgyddkngpeqwsklypiangnnqspvdiktsetkhdtslkpisvsynpatakeiinvgh
sfhvnfednqdrsvlkggpfsdsyrlfqfhfhwgstnehgsehtvdgvkysaelhvahwn
sakysslaeaaskadglavigvlmkvgeanpklqkvldalqaiktkgkrapftnfdpstl
lpssldfwtypgslthpplyesvtwiickesisvsseqlaqfrsllsnvegdnavpmqhn
nrptqplkgrtvrasf

Timeline for d2caba_:

• d2caba_ first appeared (with stable ids) in SCOP 1.55, called d2cab__
  
• d2caba_ appears in SCOPe 2.05
  
• d2caba_ appears in SCOPe 2.07
  
• d2caba_ appears in the current release, SCOPe 2.08