Class b: All beta proteins [48724] (180 folds) |
Fold b.15: HSP20-like chaperones [49763] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key |
Superfamily b.15.1: HSP20-like chaperones [49764] (5 families) |
Family b.15.1.0: automated matches [191643] (1 protein) not a true family |
Protein automated matches [191181] (10 species) not a true protein |
Species Sulfolobus solfataricus [TaxId:555311] [279049] (3 PDB entries) |
Domain d4ylce1: 4ylc E:1-114 [279058] Other proteins in same PDB: d4ylca2, d4ylcb2, d4ylcc2, d4ylcd2, d4ylce2, d4ylcf2, d4ylcg2, d4ylch2 automated match to d3aaca_ complexed with cl; mutant |
PDB Entry: 4ylc (more details), 3.1 Å
SCOPe Domain Sequences for d4ylce1:
Sequence, based on SEQRES records: (download)
>d4ylce1 b.15.1.0 (E:1-114) automated matches {Sulfolobus solfataricus [TaxId: 555311]} mmnvimreigkkldelsrefyesvippidmyeeggelvvvadlagfnkdkisvrlsaqne liinaereiqyigtkyatqrplkihkvirlpvkvkrdsqvtakyengvltirip
>d4ylce1 b.15.1.0 (E:1-114) automated matches {Sulfolobus solfataricus [TaxId: 555311]} mmnvimreigkkldelsrefyesvippidmyeeggelvvvadlagfnkdkisvrlsaqne liinaereiqyigtkyatqrplkihkvirlpvkvrtakyengvltirip
Timeline for d4ylce1: