Lineage for d4rzcl_ (4rzc L:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031996Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2031997Protein automated matches [190740] (28 species)
    not a true protein
  7. 2034455Species Lepus curpaeums [TaxId:9980] [279016] (1 PDB entry)
  8. 2034459Domain d4rzcl_: 4rzc L: [279019]
    Other proteins in same PDB: d4rzca_, d4rzcc_, d4rzce_, d4rzch_
    automated match to d3t0va_
    complexed with m6p, so4

Details for d4rzcl_

PDB Entry: 4rzc (more details), 2.72 Å

PDB Description: fv m6p-1 in complex with mannose-6-phosphate
PDB Compounds: (L:) Fv M6P-1 heavy chain

SCOPe Domain Sequences for d4rzcl_:

Sequence, based on SEQRES records: (download)

>d4rzcl_ b.1.1.0 (L:) automated matches {Lepus curpaeums [TaxId: 9980]}
lvmtqtespvsaavggtvtikcqssqsvynnrlawyqqkpgqrpklliysastlasgvps
rfkgsgsgtqftltisdlewgdaatyychggyrsnddryafsggteleilss

Sequence, based on observed residues (ATOM records): (download)

>d4rzcl_ b.1.1.0 (L:) automated matches {Lepus curpaeums [TaxId: 9980]}
lvmtqtespvsaaggtvtikcqssqsvynnrlawyqqkpgqrpklliysastlasgvpsr
fkgsgsgtqftltisdlewgdaatyychggyrnddryafsggteleilss

SCOPe Domain Coordinates for d4rzcl_:

Click to download the PDB-style file with coordinates for d4rzcl_.
(The format of our PDB-style files is described here.)

Timeline for d4rzcl_: