SCOPe 2.08: Domain d4pikc1: 4pik C:3-141

Lineage for d4pikc1 (4pik C:3-141)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.77: beta-Prism I [51091] (4 superfamilies)
   consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.77.3: Mannose-binding lectins [51101] (2 families)

5. Family b.77.3.0: automated matches [191397] (1 protein)
   not a true family

6. Protein automated matches [190516] (5 species)
   not a true protein

7. Species Musa acuminata [TaxId:4641] [187471] (10 PDB entries)

8. Domain d4pikc1: 4pik C:3-141 [278998]
   Other proteins in same PDB: d4pika2, d4pikb2, d4pikc2, d4pikd2
   automated match to d2bmza_
   complexed with gol, man

Details for d4pikc1

PDB Entry: 4pik, 1.7 Å

PDB Description: crystal structure of banana lectin bound to dimannose

PDB Compounds: (C:) ripening-associated protein

SCOPe Domain Sequences for d4pikc1:

Sequence; same for both SEQRES and ATOM records:

>d4pikc1 b.77.3.0 (C:3-141) automated matches {Musa acuminata [TaxId: 4641]}
gaikvgawggnggsafdmgpayriisvkifsgdvvdgvdvtftyygktetrhyggsggtp
heivlqegeylvgmagevanyhgavvlgklgfstnkkaygpfgntggtpfslpiaagkis
gffgrggkfldaigvylep

Timeline for d4pikc1:

• d4pikc1 first appeared in SCOPe 2.05, called d4pikc_
  
• d4pikc1 appears in SCOPe 2.07