SCOPe 2.05: Domain d5fkqa1: 5fkq A:33-448

Lineage for d5fkqa1 (5fkq A:33-448)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
   consists of seven 4-stranded beta-sheet motifs; meander

4. Superfamily b.69.13: Oligoxyloglucan reducing end-specific cellobiohydrolase [110296] (2 families)
   duplication: # two beta-propeller domains are swapped with the N-terminal strands; similar domain arrangment to the Actin interacting protein 1 (89378)

5. Family b.69.13.0: automated matches [227242] (1 protein)
   not a true family

6. Protein automated matches [227008] (2 species)
   not a true protein

7. Species Cellvibrio japonicus [TaxId:498211] [278979] (2 PDB entries)

8. Domain d5fkqa1: 5fkq A:33-448 [278980]
   automated match to d3a0fa1
   complexed with br, edo, k

Details for d5fkqa1

PDB Entry: 5fkq, 1.71 Å

PDB Description: unraveling the first step of xyloglucan degradation by the soil saprophyte cellvibrio japonicus through the functional and structural characterization of a potent gh74 endo-xyloglucanase

PDB Compounds: (A:) endo-1,4-beta-glucanase/xyloglucanase, putative, gly74a

SCOPe Domain Sequences for d5fkqa1:

Sequence; same for both SEQRES and ATOM records:

>d5fkqa1 b.69.13.0 (A:33-448) automated matches {Cellvibrio japonicus [TaxId: 498211]}
mapsenytwknvridgggfvpgiifnqkeadliyartaiggayrwnsatsswiplldwvg
wdnwgwngvmslatdaadpnrvyaavgmytntwdpnngailrstdrgntwqatplpfkvg
gnmpgrgmgerlaidpnrnsiiyygaeggnglwrstdygatwakvssftnggnyaqdpnd
pndylnkiqgvvwvtfdpasgsagntsqviyvgvadtqnaiyrstdggttwsrlagqptg
flphkgvydavngvlyiaysdtggpydgakgdvwkftassgtwtnispipssssdlyfgy
sgltidrknpntlmvasqiawwpdavffrstnggaswtriwdwtsypsrsfrytmditev
pwlnfgnsnpvapevspklgwmnesveidphnsnrlmygtgatiyatenltswdsg

Timeline for d5fkqa1:

• d5fkqa1 is new in SCOPe 2.05-stable
  
• d5fkqa1 appears in SCOPe 2.06
  
• d5fkqa1 appears in the current release, SCOPe 2.08