Lineage for d4d3pa_ (4d3p A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1851756Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 1851757Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 1852137Family c.45.1.0: automated matches [191381] (1 protein)
    not a true family
  6. 1852138Protein automated matches [190475] (8 species)
    not a true protein
  7. 1852150Species Human (Homo sapiens) [TaxId:9606] [187400] (99 PDB entries)
  8. 1852161Domain d4d3pa_: 4d3p A: [278947]
    automated match to d3s4ea_
    complexed with so4

Details for d4d3pa_

PDB Entry: 4d3p (more details), 1.27 Å

PDB Description: crystal structure of point mutated dusp19 (c150a)
PDB Compounds: (A:) Dual specificity protein phosphatase 19

SCOPe Domain Sequences for d4d3pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4d3pa_ c.45.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gshmasqvgvikpwlllgsqdaahdldtlkknkvthilnvaygvenaflsdftyksisil
dlpetnilsyfpecfefieeakrkdgvvlvhanagvsraaaivigflmnseqtsftsafs
lvknarpsicpnsgfmeqlrtyqegke

SCOPe Domain Coordinates for d4d3pa_:

Click to download the PDB-style file with coordinates for d4d3pa_.
(The format of our PDB-style files is described here.)

Timeline for d4d3pa_: