SCOPe 2.05: Domain d5cura_: 5cur A:

Lineage for d5cura_ (5cur A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.18: Bacterial lipase [53570] (4 proteins)
   lack the first two strands of the common fold

6. Protein Lipase A [64145] (3 species)
   minimal alpha/beta hydrolase fold;

7. Species Bacillus subtilis [TaxId:1423] [64146] (18 PDB entries)
   Uniprot P37957 34-212

8. Domain d5cura_: 5cur A: [278937]
   automated match to d1i6wb_
   complexed with bm0, cl

Details for d5cura_

PDB Entry: 5cur, 1.3 Å

PDB Description: g158e/k44e/r57e/y49e bacillus subtilis lipase a with 20% [bmim][cl]

PDB Compounds: (A:) esterase

SCOPe Domain Sequences for d5cura_:

Sequence; same for both SEQRES and ATOM records:

>d5cura_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]}
hnpvvmvhgiggasfnfagiksylvsqgwsrdklyavdfwdetgtnenngpvlsefvqkv
ldetgakkvdivahsmggantlyyiknldggnkvanvvtlgganrlttgkalpgtdpnqk
ilytsiyssadmivmnylsrldgarnvqihgvghiellyssqvnslikeglngggqntn

Timeline for d5cura_:

• d5cura_ is new in SCOPe 2.05-stable
  
• d5cura_ appears in SCOPe 2.06
  
• d5cura_ appears in the current release, SCOPe 2.08