SCOPe 2.05: Domain d5ct4a_: 5ct4 A:

Lineage for d5ct4a_ (5ct4 A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.18: Bacterial lipase [53570] (4 proteins)
   lack the first two strands of the common fold

6. Protein Lipase A [64145] (3 species)
   minimal alpha/beta hydrolase fold;

7. Species Bacillus subtilis [TaxId:1423] [64146] (18 PDB entries)
   Uniprot P37957 34-212

8. Domain d5ct4a_: 5ct4 A: [278924]
   automated match to d1i6wb_
   complexed with bm0, cl, so4

Details for d5ct4a_

PDB Entry: 5ct4, 1.49 Å

PDB Description: wild-type bacillus subtilis lipase a with 5% [bmim][cl]

PDB Compounds: (A:) esterase

SCOPe Domain Sequences for d5ct4a_:

Sequence; same for both SEQRES and ATOM records:

>d5ct4a_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]}
hnpvvmvhgiggasfnfagiksylvsqgwsrdklyavdfwdktgtnynngpvlsrfvqkv
ldetgakkvdivahsmggantlyyiknldggnkvanvvtlgganrlttgkalpgtdpnqk
ilytsiyssadmivmnylsrldgarnvqihgvghigllyssqvnslikeglngggqntn

Timeline for d5ct4a_:

• d5ct4a_ is new in SCOPe 2.05-stable
  
• d5ct4a_ appears in SCOPe 2.06
  
• d5ct4a_ appears in the current release, SCOPe 2.08