Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.18: Bacterial lipase [53570] (4 proteins) lack the first two strands of the common fold |
Protein Lipase A [64145] (3 species) minimal alpha/beta hydrolase fold; |
Species Bacillus subtilis [TaxId:1423] [64146] (18 PDB entries) Uniprot P37957 34-212 |
Domain d5ct4a_: 5ct4 A: [278924] automated match to d1i6wb_ complexed with bm0, cl, so4 |
PDB Entry: 5ct4 (more details), 1.49 Å
SCOPe Domain Sequences for d5ct4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ct4a_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]} hnpvvmvhgiggasfnfagiksylvsqgwsrdklyavdfwdktgtnynngpvlsrfvqkv ldetgakkvdivahsmggantlyyiknldggnkvanvvtlgganrlttgkalpgtdpnqk ilytsiyssadmivmnylsrldgarnvqihgvghigllyssqvnslikeglngggqntn
Timeline for d5ct4a_: