SCOPe 2.05: Domain d5cblb_: 5cbl B:

Lineage for d5cblb_ (5cbl B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (37 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187655] (48 PDB entries)

8. Domain d5cblb_: 5cbl B: [278882]
   automated match to d3wlub_
   complexed with bme, gol, lat, so4

Details for d5cblb_

PDB Entry: 5cbl, 1.78 Å

PDB Description: crystal structure of the c-terminal domain of human galectin-4 with lactose

PDB Compounds: (B:) Galectin-4

SCOPe Domain Sequences for d5cblb_:

Sequence, based on SEQRES records:

>d5cblb_ b.29.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gpptfnppvpyfgrlqggltarrtiiikgyvpptgksfainfkvgssgdialhinprmgn
gtvvrnsllngswgseekkithnpfgpgqffdlsircgldrfkvyangqhlfdfahrlsa
fqrvdtleiqgdvtlsyvqi

Sequence, based on observed residues (ATOM records):

>d5cblb_ b.29.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gpptfnppvpyfgrlqggltarrtiiikgyvpptgksfainfkvgsgdialhinprmgng
tvvrnsllngswgseekkithnpfgpgqffdlsircgldrfkvyangqhlfdfahrlsaf
qrvdtleiqgdvtlsyvqi

Timeline for d5cblb_:

• d5cblb_ is new in SCOPe 2.05-stable
  
• d5cblb_ appears in SCOPe 2.06
  
• d5cblb_ appears in the current release, SCOPe 2.08