Lineage for d5cbla_ (5cbl A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2049732Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2049733Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2051795Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2051796Protein automated matches [190437] (53 species)
    not a true protein
  7. 2052020Species Human (Homo sapiens) [TaxId:9606] [187655] (78 PDB entries)
  8. 2052088Domain d5cbla_: 5cbl A: [278881]
    automated match to d3wlub_
    complexed with bme, gol, lat, so4

Details for d5cbla_

PDB Entry: 5cbl (more details), 1.78 Å

PDB Description: crystal structure of the c-terminal domain of human galectin-4 with lactose
PDB Compounds: (A:) Galectin-4

SCOPe Domain Sequences for d5cbla_:

Sequence, based on SEQRES records: (download)

>d5cbla_ b.29.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gpptfnppvpyfgrlqggltarrtiiikgyvpptgksfainfkvgssgdialhinprmgn
gtvvrnsllngswgseekkithnpfgpgqffdlsircgldrfkvyangqhlfdfahrlsa
fqrvdtleiqgdvtlsyvqi

Sequence, based on observed residues (ATOM records): (download)

>d5cbla_ b.29.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gpptfnppvpyfgrltarrtiiikgyvpptgksfainfkvsgdialhinprmgngtvvrn
sllngswgseekkithnpfgpgqffdlsircgldrfkvyangqhlfdfahrlsvdtleiq
gdvtlsyvqi

SCOPe Domain Coordinates for d5cbla_:

Click to download the PDB-style file with coordinates for d5cbla_.
(The format of our PDB-style files is described here.)

Timeline for d5cbla_: