SCOPe 2.01: Domain d1fqma_: 1fqm A:

Lineage for d1fqma_ (1fqm A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
   single sheet; 10 strands

4. Superfamily b.74.1: Carbonic anhydrase [51069] (2 families)

5. Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)

6. Protein Carbonic anhydrase [51071] (10 species)

7. Species Human (Homo sapiens), erythrocytes, isozyme II [TaxId:9606] [51073] (370 PDB entries)
   Uniprot P00918

8. Domain d1fqma_: 1fqm A: [27888]
   complexed with hg, zn

Details for d1fqma_

PDB Entry: 1fqm, 2 Å

PDB Description: x-ray crystal structure of zinc-bound f93i/f95m/w97v carbonic anhydrase (caii) variant

PDB Compounds: (A:) carbonic anhydrase

SCOPe Domain Sequences for d1fqma_:

Sequence; same for both SEQRES and ATOM records:

>d1fqma_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II [TaxId: 9606]}
wgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnngh
afnvefddsqdkavlkggpldgtyrliqihmhvgsldgqgsehtvdkkkyaaelhlvhwn
tkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprgll
pesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvdnw
rpaqplknrqikasfk

Timeline for d1fqma_:

• d1fqma_ first appeared (with stable ids) in SCOP 1.55
  
• d1fqma_ appears in SCOP 1.75
  
• d1fqma_ appears in SCOPe 2.02
  
• d1fqma_ appears in the current release, SCOPe 2.08