Lineage for d5cbea_ (5cbe A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1765207Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)
  8. 1766252Domain d5cbea_: 5cbe A: [278867]
    Other proteins in same PDB: d5cbeb_, d5cbed_, d5cbee_, d5cbef_
    automated match to d4odxh_
    complexed with edo

Details for d5cbea_

PDB Entry: 5cbe (more details), 2.4 Å

PDB Description: e10 in complex with cxcl13
PDB Compounds: (A:) E10 heavy chain

SCOPe Domain Sequences for d5cbea_:

Sequence, based on SEQRES records: (download)

>d5cbea_ b.1.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvqlvqsgaevkkpgssvkvsckasggtfssyaiswvrqapgqglewmggiipifgtany
aqkfqgrvtitadeststaymelsslrsedtavyycarepdyydssgyypidafdiwgqg
ttvtvss

Sequence, based on observed residues (ATOM records): (download)

>d5cbea_ b.1.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvqlvqsgaevkkpgssvkvsckasgfssyaiswvrqapgqglewmggiipifgtanyaq
kfqgrvtitadeststaymelsslrsedtavyycarepdyydssgyypidafdiwgqgtt
vtvss

SCOPe Domain Coordinates for d5cbea_:

Click to download the PDB-style file with coordinates for d5cbea_.
(The format of our PDB-style files is described here.)

Timeline for d5cbea_: