![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (28 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries) |
![]() | Domain d5cbaa_: 5cba A: [278850] Other proteins in same PDB: d5cbab1, d5cbab2, d5cbad1, d5cbad2, d5cbae_, d5cbaf_ automated match to d4odxh_ complexed with edo, peg |
PDB Entry: 5cba (more details), 2.5 Å
SCOPe Domain Sequences for d5cbaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5cbaa_ b.1.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} qvqlvqsgaevkkpgssvkvsckasggtfssyaiswvrqapgqglewmggiipifgtany aqkfqgrvtitadeststaymelsslrsedtavyycarepdyydssgyypidafdiwgqg ttvtvss
Timeline for d5cbaa_: